General Information

  • ID:  hor006234
  • Uniprot ID:  P70107
  • Protein name:  Uroguanylin
  • Gene name:  GUCA2B
  • Organism:  Cavia porcellus (Guinea pig)
  • Family:  Guanylin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Cavia (genus), Caviidae (family), Hystricomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0030250 guanylate cyclase activator activity
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NDECELCVNIACTGC
  • Length:  15(97-111)
  • Propeptide:  MGSRTLLGHLSVLAVVLLLLLQGTQSVDIKYQGYQVQLESVKKLKALEEQWVSSPRLQAQDPQPAVCHHPALPLDLQPICTSQEAASILQALRTMDNDECELCVNIACTGC
  • Signal peptide:  MGSRTLLGHLSVLAVVLLLLLQGTQS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an auto
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  4-12; 7-15
  • Structure ID:  AF-P70107-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006234_AF2.pdbhor006234_ESM.pdb

Physical Information

Mass: 183671 Formula: C60H99N17O25S4
Absent amino acids: FHKMPQRSWY Common amino acids: C
pI: 3.42 Basic residues: 0
Polar residues: 8 Hydrophobic residues: 4
Hydrophobicity: 38 Boman Index: -1644
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 78
Instability Index: 10826 Extinction Coefficient cystines: 250
Absorbance 280nm: 17.86

Literature

  • PubMed ID:  NA
  • Title:  NA